DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and vha-3

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001367642.1 Gene:vha-3 / 177018 WormBaseID:WBGene00006912 Length:161 Species:Caenorhabditis elegans


Alignment Length:154 Identity:108/154 - (70%)
Similarity:124/154 - (80%) Gaps:1/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIY 70
            :::...|.||||.||||||.||:.||||||||||..||.:|.||||||||||:|||:|||||.||
 Worm     7 TAERAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIY 71

  Fly    71 GLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |||||:::.|.:...|. |.|.:||.||.|||..|..||.||:||||||||||||||||||||||
 Worm    72 GLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVG 136

  Fly   135 MILILIFAEVLGLYGLIVAIYLYT 158
            |||||||:|||||||:|||:.|.|
 Worm   137 MILILIFSEVLGLYGMIVALILGT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 73/107 (68%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 52/66 (79%)
vha-3NP_001367642.1 V_ATP_synt_C 16..124 CDD:130170 73/107 (68%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 52/65 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I4404
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 210 1.000 Inparanoid score I2374
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm4729
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.