DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and vha-1

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_499165.1 Gene:vha-1 / 176383 WormBaseID:WBGene00006910 Length:169 Species:Caenorhabditis elegans


Alignment Length:153 Identity:95/153 - (62%)
Similarity:122/153 - (79%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 69
            :.::..:||||||.:|..||:.|:|.|:||||||:|||||:|:|.||:|:||:|||||||||:||
 Worm    14 LKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARPDLVMKAIIPVVMAGIVAI 78

  Fly    70 YGLVVAVLIAGALEEP-SKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFV 133
            |||||||:::|.:|.. :.|::...|.....||..|..||.||:||||.||||||..:||||:||
 Worm    79 YGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGAGYAIGIAGDAGVRALSQQPRMFV 143

  Fly   134 GMILILIFAEVLGLYGLIVAIYL 156
            ||||||||||||||||:|||:.|
 Worm   144 GMILILIFAEVLGLYGMIVALIL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 63/107 (59%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 44/67 (66%)
vha-1NP_499165.1 ATP-synt_C 24..132 CDD:294318 63/107 (59%)
ATP-synt_C 107..166 CDD:278563 42/58 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I4404
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.