DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Atp6v0c

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_570836.1 Gene:Atp6v0c / 170667 RGDID:621394 Length:155 Species:Rattus norvegicus


Alignment Length:152 Identity:127/152 - (83%)
Similarity:138/152 - (90%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 72
            :||.|..|||||||:||::|||:||||||||||||||||||||||||||||||||||||||||||
  Rat     6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 70

  Fly    73 VVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 137
            |||||||.:|.:  ..:|||.|:.|||||:||.||||||||||||||||||||||||||||||||
  Rat    71 VVAVLIANSLTD--GITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 133

  Fly   138 ILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||:.|.||
  Rat   134 ILIFAEVLGLYGLIVALILSTK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 88/106 (83%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 59/66 (89%)
Atp6v0cNP_570836.1 V_ATP_synt_C 13..118 CDD:130170 88/106 (83%)
ATP-synt_Vo_c_ATP6C_rpt2 86..153 CDD:349416 59/66 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337650
Domainoid 1 1.000 109 1.000 Domainoid score I6226
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68199
Inparanoid 1 1.050 238 1.000 Inparanoid score I3289
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - otm44632
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - LDO PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.