DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Atp6v0b

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_291095.1 Gene:Atp6v0b / 114143 MGIID:1890510 Length:205 Species:Mus musculus


Alignment Length:150 Identity:53/150 - (35%)
Similarity:83/150 - (55%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PF-FGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVL 77
            || :..:|...||..|.:|||:|...:|:.|....|..|.:..|:::.::....:||||:::|::
Mouse    46 PFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIV 110

  Fly    78 IAGALE-----EPSKY---SLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |:...|     ||...   :.:.|:...||||.||.|.|..|..:||||.......||.|.|||.
Mouse   111 ISNMAEPFSATEPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVK 175

  Fly   135 MILILIFAEVLGLYGLIVAI 154
            ::::.||...:||:|:||||
Mouse   176 ILIVEIFGSAIGLFGVIVAI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 37/115 (32%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 28/64 (44%)
Atp6v0bNP_291095.1 ATP-synt_Vo_c_ATP6F_rpt1 49..111 CDD:349417 18/61 (30%)
ATP-synt_Vo_c_ATP6F_rpt2 133..197 CDD:349418 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.