DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASPA and ntc

DIOPT Version :10

Sequence 1:NP_000040.1 Gene:ASPA / 443 HGNCID:756 Length:313 Species:Homo sapiens
Sequence 2:NP_647829.1 Gene:ntc / 38443 FlyBaseID:FBgn0035461 Length:314 Species:Drosophila melanogaster


Alignment Length:203 Identity:37/203 - (18%)
Similarity:69/203 - (33%) Gaps:70/203 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    42 QRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENL-GKKMSEDLPY----------EVRRAQE 95
            :::..|..|.|.....::...:::|..||:..:...: ..:....|.|          |...||:
  Fly    58 EKSTQETNPLILEHATLEWVPQHMDKLLNQYQECRKMPAAEWLHLLTYLVALECGFVEEETFAQK 122

Human    96 INHLFGPKDSEDS---------------YDIIF-------------DLH-----NTTSNMGCTLI 127
             .||..|..|..|               |::.|             |.|     :..:.:.|.|:
  Fly   123 -RHLIQPVPSFSSFHAQNVRILSEQPARYEVCFNDTVYIMRLRTLLDKHAPEETSLVAALQCRLM 186

Human   128 LEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLK--YATTRSIAKYPVGIEVGPQPQGVLRAD 190
            .....:..:|        :|:|.|        ||.:  |:.:.||.:|.:.|:...:|       
  Fly   187 AVSLGDQLMI--------TLSPAP--------PSKEPGYSVSLSIGRYVLNIQAKNKP------- 228

Human   191 ILDQMRKM 198
            |..:.||:
  Fly   229 IYHRFRKL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASPANP_000040.1 Peptidase_M14_like 10..300 CDD:472171 37/203 (18%)
ntcNP_647829.1 F-box-like 267..>298 CDD:463757
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.