DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and pphB

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_417214.1 Gene:pphB / 947196 ECOCYCID:G7415 Length:218 Species:Escherichia coli


Alignment Length:72 Identity:27/72 - (37%)
Similarity:40/72 - (55%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 ICGDIHGQYTDLL--RLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG 253
            :.|||||:| .||  ||.:...||.....:.:||.:|||.:||:.:.||     ..|. |..::|
E. coli    19 VVGDIHGEY-QLLQSRLHQLSFFPKIDLLISVGDNIDRGPESLDVLRLL-----NQPW-FTSVKG 76

  Fly   254 NHECASI 260
            |||..::
E. coli    77 NHEAMAL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 27/72 (38%)
PP2Ac 160..430 CDD:197547 27/72 (38%)
pphBNP_417214.1 PRK09968 1..218 CDD:182173 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.