DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PPN2

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_014182.1 Gene:PPN2 / 855504 SGDID:S000005161 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:240 Identity:49/240 - (20%)
Similarity:86/240 - (35%) Gaps:72/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 CLKSREIF------LQQPILL--------------ELEAPLIICGDIHGQYTDLLRLFE--YGGF 211
            |:.:..||      |..|:.|              :|....:..||:||.|.:.:.|.:  .||.
Yeast    23 CVYTLYIFKFDNPRLSPPVSLLPTISTLKKIEHVTDLNKEYVFVGDVHGNYDEFIELIDDKIGGL 87

  Fly   212 PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE----CASINRIYGFYDECKR 272
            ......:.|||::.:|..|.:.:..:|.:|    :....:.||||    .|.:|   ..:.:..|
Yeast    88 GENITMILLGDFIHKGPDSDKVVSYILNHK----DQVKCVLGNHEILVMMAYLN---PDFSKWVR 145

  Fly   273 RYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRL------------------ 319
            |..:....||:...|.:|...   .||...||.|:.:| |..::.:|                  
Yeast   146 RPKLMTPLTFSTETNFIPQDI---SKISNAHGRLAREL-GFSKLSQLAEHCSMAIELDLDITGDI 206

  Fly   320 -------------MRPTDVPDTGLLCDLLWSDPDKDVQGWGENDR 351
                         |:|..:|....|.::.:.|.    :.|.:..|
Yeast   207 LFGAHAGMVPGDFMKPNQIPGVSSLSNMKYVDK----KNWSKTSR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 49/240 (20%)
PP2Ac 160..430 CDD:197547 49/240 (20%)
PPN2NP_014182.1 MPP_PPP_family 64..307 CDD:277316 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.