DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and SIT4

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_010236.1 Gene:SIT4 / 851513 SGDID:S000002205 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:127/282 - (45%)
Similarity:183/282 - (64%) Gaps:9/282 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFE-YGG 210
            |.::.|:.     :||.|::.||...:|:.:::..:..::.|:.:|||||||:.|||.||. .||
Yeast    11 ETIKKCQA-----LTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGG 70

  Fly   211 FPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY- 274
            ||...||:|||||||||..||||..||:..|:|||....|:|||||...|.::||||:||..:| 
Yeast    71 FPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYG 135

  Fly   275 NVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDP 339
            :..:||.....|:.|.:|||||.||.|.||||||:::.::|||.|.|..:||..|...|||||||
Yeast   136 STTVWKYCCQVFDFLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDP 200

  Fly   340 DKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEF-FARRQLVTLFSAPNYC 403
            | :|:.|..:.||..:.||..|..:|.:.:.|:||.||||:|.:|::: |..:.:||::||||||
Yeast   201 D-NVEAWQVSPRGAGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYC 264

  Fly   404 GEFDNAGGMMTVDDTLMCSFQI 425
            ....|...:|.||:.|..:|:|
Yeast   265 YRCGNVASVMKVDEDLEPTFKI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 126/280 (45%)
PP2Ac 160..430 CDD:197547 125/269 (46%)
SIT4NP_010236.1 MPP_PP2A_PP4_PP6 7..291 CDD:277360 127/282 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.