DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and AT1G48120

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_175246.2 Gene:AT1G48120 / 841230 AraportID:AT1G48120 Length:1340 Species:Arabidopsis thaliana


Alignment Length:301 Identity:91/301 - (30%)
Similarity:140/301 - (46%) Gaps:72/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 LCLKSREIFLQQPILLELE---APLIICGDIHGQYTDLLRLFEYGGFPPAAN-YLFLGDYVDRGK 228
            |.|.:.:|..::|..:.::   |.:::.||:|||..|||.|.:..|||.... |:|.|:|||.|.
plant   631 LVLFASKILKKEPNCVRIDSEKAEVVVVGDLHGQLHDLLYLMQDAGFPDGDRFYVFNGNYVDIGA 695

  Fly   229 QSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVK---LWKTFTDCFNCLP 290
            ..|||..|||::|:..|...:||||:||..|...:|||.:|...:|..|   ::|...:||..||
plant   696 WGLETFLLLLSWKVLLPARVYLLRGSHESESCTSMYGFKNEVLTKYGDKGAAVYKKCLECFQLLP 760

  Fly   291 VAAIIDEKIFCCHGGLSPD-----------------------------------------LQGME 314
            :|::|..|::..||||..|                                         |:.:.
plant   761 LASVIAGKVYTAHGGLFRDVSSFLSDKQERNRKRKRTQKKQTDNTVLDTEDRSESLPLGSLKDLS 825

  Fly   315 QIRRLMRPTDVPDTG---LLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICR 376
            :::|  |..|.|..|   :..|:|||||.||...:...:||:...:|.|..:|||..:.|..|.|
plant   826 KVKR--RVIDPPTEGSNLIPGDILWSDPSKDTGLFLNKERGIGLLWGPDCTAKFLQDNNLKWIIR 888

  Fly   377 AHQVVEDGYEFFARRQ---------------LVTLFSAPNY 402
            .....::.    |:|.               |:||||||::
plant   889 GKGAPDER----AKRDDLAPMNGGYAEDHEGLITLFSAPDH 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 91/301 (30%)
PP2Ac 160..430 CDD:197547 91/301 (30%)
AT1G48120NP_175246.2 PMD 78..435 CDD:287502
MPP_PP7 589..971 CDD:163661 91/301 (30%)
PP2Ac 631..961 CDD:197547 91/301 (30%)
Ehrlichia_rpt 981..>1325 CDD:118064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.