DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and TOPP8

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001330891.1 Gene:TOPP8 / 832846 AraportID:AT5G27840 Length:330 Species:Arabidopsis thaliana


Alignment Length:281 Identity:201/281 - (71%)
Similarity:247/281 - (87%) Gaps:0/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLF 219
            |||||::|:|:|.||..:|:|||.||.||:|.||:.|||||||||.||||||||||:||:|||||
plant    27 GKQVQLSESEIRQLCFNARQIFLSQPNLLDLHAPIRICGDIHGQYQDLLRLFEYGGYPPSANYLF 91

  Fly   220 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTD 284
            |||||||||||||||||||||||:||...:|||||||.|.||||||||||||||:||:|||.|||
plant    92 LGDYVDRGKQSLETICLLLAYKIRYPSKIYLLRGNHEDAKINRIYGFYDECKRRFNVRLWKVFTD 156

  Fly   285 CFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN 349
            |||||||||:|||||.|.||||||||..:.|||.:.||.::||:||||||||||||:.::||.::
plant   157 CFNCLPVAALIDEKILCMHGGLSPDLDNLNQIREIQRPIEIPDSGLLCDLLWSDPDQKIEGWADS 221

  Fly   350 DRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMT 414
            |||:|.|||.|.|::||::::||||||.||||||||||||:|:|||:||||||.|||||||.:::
plant   222 DRGISCTFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLS 286

  Fly   415 VDDTLMCSFQILKPSEKKAKY 435
            ||::|:|||:|:||:...:.:
plant   287 VDESLVCSFEIMKPAPASSSH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 199/272 (73%)
PP2Ac 160..430 CDD:197547 196/269 (73%)
TOPP8NP_001330891.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.