DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and TOPP7

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_567375.1 Gene:TOPP7 / 826726 AraportID:AT4G11240 Length:322 Species:Arabidopsis thaliana


Alignment Length:296 Identity:225/296 - (76%)
Similarity:264/296 - (89%) Gaps:1/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 RTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANY 217
            ||.||.|:||.|:|.|||.|:|:||.||.|||||||:.||||:|||:.||||||||||:||||||
plant    20 RTVKQAQITETEIRQLCLASKEVFLSQPNLLELEAPIKICGDVHGQFPDLLRLFEYGGYPPAANY 84

  Fly   218 LFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTF 282
            |||||||||||||:||||||||||:||..||||||||||||||||:|||||||||||||:|||||
plant    85 LFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRGNHECASINRVYGFYDECKRRYNVRLWKTF 149

  Fly   283 TDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWG 347
            |:|||||||:|:||:||.|.|||||||::.::.|||:.||.||||.|:||||||:|||:::||||
plant   150 TECFNCLPVSALIDDKILCMHGGLSPDIKSLDDIRRIPRPIDVPDQGILCDLLWADPDREIQGWG 214

  Fly   348 ENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGM 412
            |||||||:|||.|.|::||..|:|||||||||||||||||||:|||||:||||||||||||||.:
plant   215 ENDRGVSYTFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAL 279

  Fly   413 MTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTP 448
            |:|||:|.|||||||.||||.::.::. |..||.||
plant   280 MSVDDSLTCSFQILKASEKKGRFGFNN-NVPRPGTP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 215/274 (78%)
PP2Ac 160..430 CDD:197547 211/269 (78%)
TOPP7NP_567375.1 MPP_PP1_PPKL 6..294 CDD:277359 214/273 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 107 1.000 Domainoid score I2174
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37659
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.