DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and TOPP9

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_187209.1 Gene:TOPP9 / 819724 AraportID:AT3G05580 Length:318 Species:Arabidopsis thaliana


Alignment Length:301 Identity:208/301 - (69%)
Similarity:250/301 - (83%) Gaps:12/301 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLF 219
            |||||::|.|:|.||:.:|:|||.||.||||.||:.|||||||||.||||||||||:||:|||||
plant    27 GKQVQLSEVEIRQLCVNARQIFLSQPNLLELHAPIRICGDIHGQYQDLLRLFEYGGYPPSANYLF 91

  Fly   220 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTD 284
            |||||||||||||||||||||||:||...||||||||.|.||||||||||||||:||:|||.|||
plant    92 LGDYVDRGKQSLETICLLLAYKIRYPSKIFLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTD 156

  Fly   285 CFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN 349
            |||||||||:|||||.|.||||||:|:.:.|||.:.|||::||.||||||||||||:..:||.::
plant   157 CFNCLPVAALIDEKILCMHGGLSPELENLGQIREIQRPTEIPDNGLLCDLLWSDPDQKNEGWTDS 221

  Fly   350 DRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMT 414
            |||:|.|||.|||:.||::::||||||.||||||||||||:|:|||:||||||.|||||||.:::
plant   222 DRGISCTFGADVVADFLDKNDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLS 286

  Fly   415 VDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPML 455
            ||.:|:|||:||||:...:            |.|.:..|.:
plant   287 VDQSLVCSFEILKPAPASS------------TNPLKKVPKM 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 203/272 (75%)
PP2Ac 160..430 CDD:197547 200/269 (74%)
TOPP9NP_187209.1 MPP_PP1_PPKL 13..300 CDD:277359 203/272 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.