DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and TOPP4

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_181514.1 Gene:TOPP4 / 818571 AraportID:AT2G39840 Length:321 Species:Arabidopsis thaliana


Alignment Length:290 Identity:233/290 - (80%)
Similarity:263/290 - (90%) Gaps:0/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            ||..|.|||||::|||::.||..:|:||||||.|||||||:.|||||||||:|||||||||||||
plant    29 VRLARPGKQVQLSEAEIKQLCTTARDIFLQQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPP 93

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
            :|||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||:||::
plant    94 SANYLFLGDYVDRGKQSLETICLLLAYKIKYPGNFFLLRGNHECASINRIYGFYDECKRRFNVRV 158

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            ||.||||||||||||:||:||.|.||||||||..:::||.|.|||.:||||||||||||||.|||
plant   159 WKVFTDCFNCLPVAALIDDKILCMHGGLSPDLDHLDEIRNLPRPTMIPDTGLLCDLLWSDPGKDV 223

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            :|||.||||||:|||.|.||:||.:|:|||:|||||||||||||||.|||||:||||||||||||
plant   224 KGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQLVTVFSAPNYCGEFDN 288

  Fly   409 AGGMMTVDDTLMCSFQILKPSEKKAKYLYS 438
            ||.||:||:.||||||||||:|||.|::.|
plant   289 AGAMMSVDENLMCSFQILKPAEKKTKFMMS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 226/278 (81%)
PP2Ac 160..430 CDD:197547 220/269 (82%)
TOPP4NP_181514.1 MPP_PP1_PPKL 18..308 CDD:277359 226/278 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.