DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:295 Identity:174/295 - (58%)
Similarity:221/295 - (74%) Gaps:1/295 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLL 203
            |..|..:|..: |.:..:::.:.|:::..|..::|::.:.:|:||.:|||:.:.|||||||.|||
  Fly    15 KYLDEMIASLL-SWKIDRKMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLL 78

  Fly   204 RLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 268
            |.||..|.||...||.|||||||||.|:||:.||||||::||.:..|||||||.|:|||.|||||
  Fly    79 RYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYD 143

  Fly   269 ECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCD 333
            |||||:.::||:.|.||::||||||||:.|||||||||||.|..:..|:.|.||.:|...|||||
  Fly   144 ECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCD 208

  Fly   334 LLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFS 398
            |||||||....||.:|.||||||||||:|..||:|...||||||||||||||||||:|||:|:||
  Fly   209 LLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFS 273

  Fly   399 APNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKA 433
            |.||||||||||.||.||..|..:..::||.::.|
  Fly   274 AVNYCGEFDNAGAMMCVDAELNITLVVMKPKKRIA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 168/278 (60%)
PP2Ac 160..430 CDD:197547 169/269 (63%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 170/286 (59%)
PP2Ac 36..305 CDD:197547 169/268 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.