DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PPP6C

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:287 Identity:124/287 - (43%)
Similarity:176/287 - (61%) Gaps:12/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 LCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLE 232
            ||....::.|::..:..:..|:.:|||||||:.||..||..||..|..||:|:||:||||..|||
Human    64 LCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLE 128

  Fly   233 TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NVKLWKTFTDCFNCLPVAAIID 296
            |...|||.|.|:|:...|||||||...|.::|||||||:.:| |...|:..|..|:.|.|||:||
Human   129 TFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALID 193

  Fly   297 EKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDV 361
            |:|.|.|||||||::.::|||.:.|..::|..|..|||:||||: ||..|..:.||..:.||..|
Human   194 EQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE-DVDTWAISPRGAGWLFGAKV 257

  Fly   362 VSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQIL 426
            .::|::.:.|.|||||||:|.:||:|....:|||::||||||....|...:|...|.        
Human   258 TNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDV-------- 314

  Fly   427 KPSEKKAKYLYSGMNSSRPTTPQRSAP 453
              :.::.|...:..:|.|...|:.:.|
Human   315 --NTREPKLFRAVPDSERVIPPRTTTP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 119/260 (46%)
PP2Ac 160..430 CDD:197547 119/262 (45%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 120/272 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.