DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PPP2CB

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001009552.1 Gene:PPP2CB / 5516 HGNCID:9300 Length:309 Species:Homo sapiens


Alignment Length:289 Identity:138/289 - (47%)
Similarity:191/289 - (66%) Gaps:7/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGF 211
            |.:..|:     |:.|.:||.||.|::||..::..:.|:..|:.:|||:|||:.||:.||..||.
Human    15 EQLNECK-----QLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGK 74

  Fly   212 PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-N 275
            .|..||||:|||||||..|:||:.||:|.|::|||...:||||||...|.::|||||||.|:| |
Human    75 SPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGN 139

  Fly   276 VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPD 340
            ..:||.|||.|:.||:.|::|.:|||.||||||.:..::.||.|.|..:||..|.:|||||||||
Human   140 ANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPD 204

  Fly   341 KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGE 405
             |..|||.:.||..:|||.|:...|.:.:.|.|:.||||:|.:||.:...|.:||:|||||||..
Human   205 -DRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268

  Fly   406 FDNAGGMMTVDDTLMCSFQILKPSEKKAK 434
            ..|...:|.:||||..||....|:.::.:
Human   269 CGNQAAIMELDDTLKYSFLQFDPAPRRGE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 136/279 (49%)
PP2Ac 160..430 CDD:197547 135/270 (50%)
PPP2CBNP_001009552.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 138/283 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.