DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and ppp2caa

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001017886.1 Gene:ppp2caa / 550585 ZFINID:ZDB-GENE-050417-441 Length:309 Species:Danio rerio


Alignment Length:289 Identity:135/289 - (46%)
Similarity:192/289 - (66%) Gaps:7/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGF 211
            |.:..|:     |::|.:|:.||.|::||..::..:.|:..|:.:|||:|||:.||:.||:.||.
Zfish    15 EQLNECK-----QLSENQVKILCEKAKEILSKESNVQEVRCPVTVCGDVHGQFHDLMELFKIGGK 74

  Fly   212 PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-N 275
            .|..||||:|||||||..|:||:.||::.|::|.|...:||||||...|.::|||||||.|:| |
Zfish    75 SPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYRERITILRGNHESRQITQVYGFYDECLRKYGN 139

  Fly   276 VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPD 340
            ..:||.|||.|:.||:.|::|.:|||.||||||.:..::.||.|.|..:||..|.:|||||||||
Zfish   140 ANVWKYFTDLFDYLPLTALVDTQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPD 204

  Fly   341 KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGE 405
             |..|||.:.||..:|||.|:...|.:.:.|.|:.||||:|.:||.:...|.:||:|||||||..
Zfish   205 -DRGGWGISPRGAGYTFGQDISETFNHANCLTLVSRAHQLVMEGYNWCHERNVVTIFSAPNYCYR 268

  Fly   406 FDNAGGMMTVDDTLMCSFQILKPSEKKAK 434
            ..|...:|.:||||..||....|:.::.:
Zfish   269 CGNQAAIMELDDTLKYSFLQFDPAPRRGE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 133/279 (48%)
PP2Ac 160..430 CDD:197547 132/270 (49%)
ppp2caaNP_001017886.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 135/283 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.