DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PPEF1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:338 Identity:99/338 - (29%)
Similarity:155/338 - (45%) Gaps:77/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KQVQMTEAE-VRGLCLKSREIFLQQPILLELEA----PLIICGDIHGQYTDLLRLFEYGGFPPAA 215
            |:.|:..|. |..:..:::::..|.|....::.    .:.||||:||:..||..:|...|.|...
Human   129 KEQQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSER 193

  Fly   216 N-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNV--- 276
            | |:|.||:|||||.|:|.:.:|....:.||.:..|.|||||...:|..|||..|...:|.:   
Human   194 NPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGK 258

  Fly   277 KLWKTFTDCFNCLPVAAIIDEKIFCCHGGLS--PDLQGMEQIRR------LMRPTDV-------- 325
            ::.:...:.:..||:..|:|.:|...|||:|  .||..:.::.|      |:.||:.        
Human   259 RILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDS 323

  Fly   326 --------------------PDTGL-------LCDLLWSDPDKDVQGWGEND------RGVSFTF 357
                                |...|       :.|:|||||.      |:|.      ||....|
Human   324 KHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPR------GKNGCFPNTCRGGGCYF 382

  Fly   358 GVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCS 422
            |.||.||.||:::|.::.|:|:...:|||.....::||:|||.||..|..|.|..:.     :||
Human   383 GPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIK-----LCS 442

  Fly   423 --------FQILK 427
                    :|:.|
Human   443 GTTPRFFQYQVTK 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 99/338 (29%)
PP2Ac 160..430 CDD:197547 97/334 (29%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 97/333 (29%)
Catalytic 121..455 98/336 (29%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.