DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PpD6

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster


Alignment Length:290 Identity:175/290 - (60%)
Similarity:224/290 - (77%) Gaps:4/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LKLRDFF--VAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYT 200
            |.|.|..  :..|.||  ..:::.:.|:||..||..:||:||.:|:||.:.||:.:.||||||:.
  Fly    30 LNLNDLLNKLMSFRRS--KMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFY 92

  Fly   201 DLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYG 265
            |||::.:..|:||...||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:||
  Fly    93 DLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYG 157

  Fly   266 FYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGL 330
            |:|||||||.|||||||.||:||:||||||..:||||||||||.|:.:..|..:.|||:||:|||
  Fly   158 FFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGL 222

  Fly   331 LCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVT 395
            ||||||||||:...||..:|||||:.:|.||:.|||.:::.||:|||||||||||||||:|||||
  Fly   223 LCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVT 287

  Fly   396 LFSAPNYCGEFDNAGGMMTVDDTLMCSFQI 425
            :||||||||.:||||..|.||..|:.||.|
  Fly   288 VFSAPNYCGLYDNAGASMGVDKDLVISFDI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 171/277 (62%)
PP2Ac 160..430 CDD:197547 169/266 (64%)
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 168/265 (63%)
PP2Ac 54..315 CDD:197547 166/260 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.