DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PpY-55A

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001286554.1 Gene:PpY-55A / 48532 FlyBaseID:FBgn0003140 Length:314 Species:Drosophila melanogaster


Alignment Length:277 Identity:181/277 - (65%)
Similarity:221/277 - (79%) Gaps:0/277 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLF 219
            |.:..:.|..:..|..::||:...||:||||:||:.||||||||:|||||:|:..||||.|||||
  Fly    21 GSECTLKEELIERLIQQTREVIKWQPMLLELQAPVNICGDIHGQFTDLLRIFKACGFPPKANYLF 85

  Fly   220 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTD 284
            ||||||||||||||||||.|||:|||.||||||||||.||||:|||||||.|||:.|:||.:|||
  Fly    86 LGDYVDRGKQSLETICLLFAYKVKYPLNFFLLRGNHESASINKIYGFYDEIKRRHTVRLWHSFTD 150

  Fly   285 CFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN 349
            |||.|||||::.|:||||||||||.|:.::||..:.||||:||.|::|||||:|.:...:|||.|
  Fly   151 CFNWLPVAALVGERIFCCHGGLSPSLRNLQQINHIQRPTDIPDEGIMCDLLWADLNHTTKGWGHN 215

  Fly   350 DRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMT 414
            ||||||||...:|..||...:|.|:.|||:||||||||||.|||||:||||||||..:||||:|:
  Fly   216 DRGVSFTFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFSAPNYCGMMNNAGGVMS 280

  Fly   415 VDDTLMCSFQILKPSEK 431
            |...|:|||.|:.|..|
  Fly   281 VSTDLICSFVIILPCHK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 179/272 (66%)
PP2Ac 160..430 CDD:197547 179/269 (67%)
PpY-55ANP_001286554.1 PTZ00480 8..310 CDD:185658 181/277 (65%)
MPP_PP1_PPKL 8..294 CDD:277359 179/272 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438844
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.