DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Pp1-13C

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:286 Identity:248/286 - (86%)
Similarity:262/286 - (91%) Gaps:0/286 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            ||..|.||.||::|.|:||||||||||.|.|||||||||||.|||||||||.||||||||||:||
  Fly    17 VRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPP 81

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
            .||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||||.:||
  Fly    82 EANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKL 146

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            |||||||||||||.||:|||||||||||||||..||||||:||||||||.||||||||||||||.
  Fly   147 WKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDT 211

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            .||||||||||||||.:||.|||.:|:|||||||||||||||||||:||||||||||||||||||
  Fly   212 IGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN 276

  Fly   409 AGGMMTVDDTLMCSFQILKPSEKKAK 434
            ||.||:||:|||||||||||.||:.|
  Fly   277 AGAMMSVDNTLMCSFQILKPVEKRKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 243/278 (87%)
PP2Ac 160..430 CDD:197547 238/269 (88%)
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 245/281 (87%)
MPP_PP1_PPKL 6..296 CDD:277359 243/278 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438841
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
1110.800

Return to query results.
Submit another query.