DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Pp4-19C

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:300 Identity:133/300 - (44%)
Similarity:201/300 - (67%) Gaps:11/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGF 211
            |.::.|...|     |.||:.||.|:|||.:::..:..:::|:.:|||||||:.||..||:.||.
  Fly    12 EQLKRCEIIK-----ENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGD 71

  Fly   212 PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-N 275
            .|..||||:||:||||..|:||..||||.|::||:...|:|||||...|.::|||||||.|:| :
  Fly    72 VPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGS 136

  Fly   276 VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPD 340
            ..:|:..|:.|:.|.::||||.||||.||||||.:|.::|||.:.|..:||..|.:||||||||:
  Fly   137 TAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE 201

  Fly   341 KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGE 405
             |..|||.:.||..:.||.||||:|...:::|:||||||:|.:|:::.....::|::||||||..
  Fly   202 -DQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265

  Fly   406 FDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRP 445
            ..|...::.:::.|...|.|.:.:.::::    |:.|.:|
  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESR----GIPSKKP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 129/279 (46%)
PP2Ac 160..430 CDD:197547 127/270 (47%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 130/283 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.