DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and PpN58A

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:293 Identity:183/293 - (62%)
Similarity:233/293 - (79%) Gaps:2/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLF 206
            |..:|:.......|..||::..|:..:|.::||:.|:||.|||:.||:.:.|||||||.:|||.|
  Fly    25 DQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYF 89

  Fly   207 EYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK 271
            |..|:||.:.||.|||||||||||:||:.||||.|.:||..|:||||||||:|||..||||||||
  Fly    90 ESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECK 154

  Fly   272 RRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLW 336
            |||.||||:||.||:||||:||||:|.||||||||||.|..|:|||.:.||.::|::||:||:||
  Fly   155 RRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILW 219

  Fly   337 SDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPN 401
            ||||..:.|||.|:||||.|||.||||.||:|.:|:||||.||||||||||||:|||:|:|||||
  Fly   220 SDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPN 284

  Fly   402 YCGEFDNAGGMMTVDDTLMCSFQILKP--SEKK 432
            |||||||||.||.::..|:|:|::.:|  ||::
  Fly   285 YCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 178/278 (64%)
PP2Ac 160..430 CDD:197547 176/271 (65%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 180/285 (63%)
MPP_superfamily 23..311 CDD:301300 180/285 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.