DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:278 Identity:137/278 - (49%)
Similarity:186/278 - (66%) Gaps:10/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFP--- 212
            :|:|..|    |.|:..:|.::||.|.::|:.||:|||:.||||||||:.|||.:|:..|||   
 Worm    31 NCQTLFQ----EKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVS 91

  Fly   213 ---PAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY 274
               .::.|||||||:|||..|:|.|.||.||::.:|:..||||||||...:|..||||:||||||
 Worm    92 QKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRY 156

  Fly   275 NVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDP 339
            :|.|::||...|.|:|:.||:..:|.|.|||:...|..:|||....||||:.|.|:..||.|:||
 Worm   157 SVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWADP 221

  Fly   340 DKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCG 404
            ...|.|:.::.||....||...|.:|..:.:||||.||||||.|||||||.::|||:||||.|||
 Worm   222 VSGVVGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYCG 286

  Fly   405 EFDNAGGMMTVDDTLMCS 422
            .|||.|.::.|...:.|:
 Worm   287 HFDNLGAVLQVATNMECT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 137/278 (49%)
PP2Ac 160..430 CDD:197547 134/269 (50%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 135/273 (49%)
MPP_superfamily 36..304 CDD:301300 134/271 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.