DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and ppp1cbl

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:313 Identity:239/313 - (76%)
Similarity:249/313 - (79%) Gaps:50/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            ||.||.||.||||||||||||:|||||||.||||||                             
Zfish    18 VRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLE----------------------------- 53

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
                             |||||||||||||||||||||||||||||||||||||||||||:|:||
Zfish    54 -----------------LETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKL 101

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            ||||||||||||:|||:||||||||||||||||.||||||:||||||||||||||||||||||||
Zfish   102 WKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDV 166

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            |||||||||||||||.||||||||||:|||||||||||||||||||:||||||||||||||||||
Zfish   167 QGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN 231

  Fly   409 AGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK 461
            |||||:||:||||||||||||||||||.|.||||.||.||    |..||..||
Zfish   232 AGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTP----PRTATPPKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 216/278 (78%)
PP2Ac 160..430 CDD:197547 210/269 (78%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 219/281 (78%)
MPP_superfamily 7..251 CDD:301300 216/278 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.