DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppef1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:329 Identity:107/329 - (32%)
Similarity:157/329 - (47%) Gaps:42/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KQVQMTEAE-VRGLCLKSREIFLQQPILLELEA----PLIICGDIHGQYTDLLRLFEYGGFPPAA 215
            ||.|...|. |..:..::|:|..|.|....::.    .:.||||:||:..||:.:|...|.|...
  Rat   154 KQQQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEK 218

  Fly   216 N-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNV--- 276
            | |:|.||:||||..|:|.:.:||...:.||.:..|.|||||...:|..|||..|..::|.:   
  Rat   219 NPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGK 283

  Fly   277 KLWKTFTDCFNCLPVAAIIDEKIFCCHGGL--SPDLQGMEQIRR------LMRPTDVPD------ 327
            |:.:...:.:..||:..|||.:|...|||:  |.||..::|::|      ||.|.....      
  Rat   284 KILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKK 348

  Fly   328 --------------TGL----LCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLI 374
                          |.|    :.|||||||......:....||....||.||.||.||:::|.::
  Rat   349 NKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMV 413

  Fly   375 CRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD-DTLMCSFQILKPSEKKAKYLYS 438
            .|:|:...||||.....:::|:|||.||..|..|.|..:.:. .|....||....|......||.
  Rat   414 IRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLNPLYQ 478

  Fly   439 GMNS 442
            .:|:
  Rat   479 RVNA 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 103/313 (33%)
PP2Ac 160..430 CDD:197547 100/311 (32%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 103/311 (33%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.