DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppef2

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_038947795.1 Gene:Ppef2 / 305246 RGDID:1307093 Length:793 Species:Rattus norvegicus


Alignment Length:514 Identity:124/514 - (24%)
Similarity:192/514 - (37%) Gaps:148/514 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SSHDPLDDLTEQQRRLLQQYSISPPSETMISADGDQITVHHPREEPKKSRLKLRDFFVAEFVRSC 152
            |||...|.|    .|:..:...:...||....|.:.|.|......|:.|...|.|...| .|.:.
  Rat   115 SSHHERDFL----NRMFTEERFAQDVETEEGGDFESIEVPDSYTGPRLSFPLLPDHATA-LVEAF 174

  Fly   153 RTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEA----PLIICGDIHGQYTDLLRLFEYGGFP- 212
            |..:|:.  ...|..|..::|....|.|.:..:..    .:.:|||:|||..||:.:|...|.| 
  Rat   175 RLRQQLH--ARYVLNLLYETRRHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPS 237

  Fly   213 PAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNV- 276
            |...|:|.||:|||||.|:|.:.:|.|:.:.||:.|.|.|||||...:|..|||..|...:|.: 
  Rat   238 PERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIH 302

  Fly   277 --KLWKTFTDCFNCLPVAAIIDEKIFCCHGG---------------------------------- 305
              |:.:|..|.|..||:|.::|||:...|||                                  
  Rat   303 GKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENLE 367

  Fly   306 -----------------------------------------------------LSPDLQGMEQIR 317
                                                                 :|.:|....|:|
  Rat   368 EQKRKDNQTSSAQKPTPWFLPQSRSLPSSPFHLGSGFKAYKACRSCSIPCGSAVSKELSRQGQVR 432

  Fly   318 RLM-------------------------RPTDVPDTGLL----------CDLLWSDPDKDVQGWG 347
            |.|                         ...|....|:|          .|:|||||... :|..
  Rat   433 RSMDLELELCRQQAGFLGIREKRESLPLADCDADAGGMLKPTPEEWKQVVDILWSDPMAQ-EGCK 496

  Fly   348 END-RGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGG 411
            .|. ||....||.||..:.:.:::|..:.|:|:...:||||...|:::|:|||.||.....|.|.
  Rat   497 ANTVRGGGCYFGPDVTEQLMEKYKLQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGA 561

  Fly   412 MMTVDDTL---MCSFQILKPS------EKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK 461
            .:.:...|   :..:|..|.:      ::.::...|.:.:.|......|:.:|...:|:
  Rat   562 YVKLGPALTPHIVQYQANKATHRLTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 102/412 (25%)
PP2Ac 160..430 CDD:197547 100/409 (24%)
Ppef2XP_038947795.1 IQ 60..79 CDD:197470
MPP_RdgC 161..577 CDD:277364 104/419 (25%)
FRQ1 617..761 CDD:227455 1/4 (25%)
EFh 697..762 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.