DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppp1ca

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:307 Identity:263/307 - (85%)
Similarity:285/307 - (92%) Gaps:3/307 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            |:..|.||.||:||.|:||||||||||||.|||||||||||.|||||||||.|||||||||||||
  Rat    19 VQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPP 83

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
            .:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||
  Rat    84 ESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKL 148

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            ||||||||||||:|||:||||||||||||||||.||||||:||||||||.|||||||||||||||
  Rat   149 WKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDV 213

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            |||||||||||||||.:||:|||::|:|||||||||||||||||||:||||||||||||||||||
  Rat   214 QGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN 278

  Fly   409 AGGMMTVDDTLMCSFQILKPSEK-KAKY-LYSGMN-SSRPTTPQRSA 452
            ||.||:||:|||||||||||::| |.|| .:||:| ..||.||.|::
  Rat   279 AGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 249/278 (90%)
PP2Ac 160..430 CDD:197547 245/269 (91%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 249/278 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.