DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppef1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:338 Identity:104/338 - (30%)
Similarity:158/338 - (46%) Gaps:51/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KQVQMTEAE-VRGLCLKSREIFLQQPILLELEA----PLIICGDIHGQYTDLLRLFEYGGFPPAA 215
            ||.|:..|. |..:..::|::..|.|....::.    .:.||||:||:..||:.:|...|.|...
Mouse   158 KQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEN 222

  Fly   216 N-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNV--- 276
            | |:|.||:||||..|:|.:.:||...:.||.:..|.|||||...:|..|||..|..::|.:   
Mouse   223 NPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGR 287

  Fly   277 KLWKTFTDCFNCLPVAAIIDEKIFCCHGGL--SPDLQGMEQIRR------LM------------- 320
            |:.:...:.:..||:..|||.:|...|||:  |.||..:.|::|      ||             
Mouse   288 KILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKR 352

  Fly   321 -------------RPTDVPDTGL-------LCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKF 365
                         .|...|...|       :.|:|||||......:....||....||.||.||.
Mouse   353 NKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKV 417

  Fly   366 LNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD-DTLMCSFQILKPS 429
            |::::|.::.|:|:...||||.....:::|:|||.||..|..|.|..:.:. .|:...||....|
Mouse   418 LSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTS 482

  Fly   430 EKKAKYLYSGMNS 442
            ......|:..||:
Mouse   483 TSCLNPLHQRMNA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 100/322 (31%)
PP2Ac 160..430 CDD:197547 97/320 (30%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 100/320 (31%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.