DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppp1cc

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:302 Identity:258/302 - (85%)
Similarity:277/302 - (91%) Gaps:6/302 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            ||..:.||.||:.|.|:||||||||||||.|||||||||||.|||||||||.|||||||||||||
Mouse    19 VRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPP 83

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
            .:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||
Mouse    84 ESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKL 148

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            ||||||||||||:|||:||||||||||||||||.||||||:||||||||.|||||||||||||||
Mouse   149 WKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDV 213

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            .||||||||||||||.:||:|||::|:|||||||||||||||||||:||||||||||||||||||
Mouse   214 LGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN 278

  Fly   409 AGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQR 450
            ||.||:||:|||||||||||:|||..      |::||.||.|
Mouse   279 AGAMMSVDETLMCSFQILKPAEKKKP------NATRPVTPPR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 247/278 (89%)
PP2Ac 160..430 CDD:197547 243/269 (90%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 247/278 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.