DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppp1cb

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:304 Identity:279/304 - (91%)
Similarity:291/304 - (95%) Gaps:0/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPP 213
            ||.||.||.||||||||||||:|||||||.|||||||||||.|||||||||||||||||||||||
Mouse    18 VRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPP 82

  Fly   214 AANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKL 278
            .|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|:||
Mouse    83 EANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKL 147

  Fly   279 WKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDV 343
            ||||||||||||:|||:||||||||||||||||.||||||:||||||||||||||||||||||||
Mouse   148 WKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDV 212

  Fly   344 QGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDN 408
            |||||||||||||||.||||||||||:|||||||||||||||||||:||||||||||||||||||
Mouse   213 QGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDN 277

  Fly   409 AGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSA 452
            |||||:||:||||||||||||||||||.|.|:||.||.||.|:|
Mouse   278 AGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 260/278 (94%)
PP2Ac 160..430 CDD:197547 254/269 (94%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 260/278 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848657
Domainoid 1 1.000 397 1.000 Domainoid score I749
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37659
Inparanoid 1 1.050 619 1.000 Inparanoid score I882
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - oto94613
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - LDO PTHR11668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2542
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.