DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and F44B9.9

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:282 Identity:87/282 - (30%)
Similarity:126/282 - (44%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TEAEVRGLCLKSR--EIFLQQPILLELEAPLIICGDIHGQYTDLLRLFE-------------YGG 210
            |.::....||...  |:|.::..|.|:..|:.|.||||||:.||:||..             ||.
 Worm     3 TYSKTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGF 67

  Fly   211 FPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN 275
              ....::|||||||||.:||:.|||:.:.||.:|:.:.|||||||..:||..|||         
 Worm    68 --STKKWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF--------- 121

  Fly   276 VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPD 340
                          .|.:::..||        |           .:|:.:.:             
 Worm   122 --------------RVCSVVVLKI--------P-----------AKPSFIRN------------- 140

  Fly   341 KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGE 405
                    |.||:|..|....|::......:.||.|.||::..|::|||.|:|.|:||||.|..|
 Worm   141 --------NKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNE 197

  Fly   406 FDNAGGMMTVDDTLMCSFQILK 427
            .||:|.:|.|......|..|:|
 Worm   198 IDNSGAVMKVASNGKISISIMK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 87/282 (31%)
PP2Ac 160..430 CDD:197547 87/282 (31%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 85/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.