DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and C27B7.6

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_501547.3 Gene:C27B7.6 / 182956 WormBaseID:WBGene00007763 Length:454 Species:Caenorhabditis elegans


Alignment Length:302 Identity:116/302 - (38%)
Similarity:157/302 - (51%) Gaps:28/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QVQMTEAEVRGLC------------------------LKS-REIFLQQPILLELEAPLIICGDIH 196
            :.:....||..||                        ||: :||....|.|:|:.||:::.||||
 Worm     3 ETEHANTEVHELCRQMIARIEKYGTLEGFSDSDILEVLKTIKEILEPLPCLIEIIAPVVVFGDIH 67

  Fly   197 GQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASIN 261
            ||..|||:.....|.||...|||||||||||..|||....|...||.:.:...|||||||...:|
 Worm    68 GQLGDLLQFTNEVGRPPDFQYLFLGDYVDRGPNSLEVTVWLFCMKILFSKKVHLLRGNHEVRRVN 132

  Fly   262 RIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVP 326
            .:|||.:|..|:.|..|||.|.|.|..|.:.|.|:.||.|.|||:||.::..:.:..:.:|....
 Worm   133 TMYGFKEEMMRKRNSHLWKVFNDVFAELSICASINRKILCMHGGISPKIESWDSLTGMTKPRVHG 197

  Fly   327 DT--GLLCDLLWSDPD-KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFF 388
            |.  ||:.||:||||: ||........||:|..||..||........:|||.|||::.|.|:.|.
 Worm   198 DCEHGLIVDLIWSDPNRKDDTIQFNKMRGISTLFGKSVVDNLCTTLAIDLIIRAHEMKEKGHTFE 262

  Fly   389 ARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSE 430
            ...:|:|:||||.|.|...|.|.:.|:..:|......|||::
 Worm   263 FDNRLLTVFSAPYYSGHNSNLGSVATISKSLKLRIVTLKPNK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 114/298 (38%)
PP2Ac 160..430 CDD:197547 116/297 (39%)
C27B7.6NP_501547.3 PP2Ac 31..304 CDD:197547 112/272 (41%)
MPP_PPP_family 61..289 CDD:277316 98/227 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.