DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and C23G10.1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001367544.1 Gene:C23G10.1 / 175880 WormBaseID:WBGene00016010 Length:454 Species:Caenorhabditis elegans


Alignment Length:330 Identity:138/330 - (41%)
Similarity:197/330 - (59%) Gaps:6/330 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ADGDQITVHHPREEP-KKSRLKLRDFFVAEFVRSCRTGK-QVQMTEAEVRGLCLKSREIFLQQPI 181
            :|.|.|.....|::. :|...:....|...|:::....| ..::...::..|....::||..|..
 Worm   119 SDNDVIKEKGARDKMFQKQSDESNKMFAEHFIKTLLACKGMTKIRTMDIFRLIHICKKIFTVQKS 183

  Fly   182 LLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPE 246
            ::|::.|:.||||:||||.||:|||..|||||.:||||||||||||..:||.|.|.||||.:||.
 Worm   184 MVEIDGPVRICGDLHGQYPDLIRLFAQGGFPPDSNYLFLGDYVDRGSFNLEVILLCLAYKARYPN 248

  Fly   247 NFFLLRGNHECASINRIYGFYDEC---KRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSP 308
            ||.:||||||...||..|||.||.   |..|:.:|:..|.:..:.:|:.|::..:|.|.|||||.
 Worm   249 NFMMLRGNHEVIHINEKYGFKDEVFNRKGEYHDELYPEFNEMMDMMPLVALVGGRILCMHGGLSQ 313

  Fly   309 DLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDL 373
            .::.::.:|.|.||....|..|..|::||||.| |.||..|.||.|..||.:.|.:.....::||
 Worm   314 HIKSLDDLRNLRRPFHSEDECLENDIMWSDPAK-VSGWTANPRGASVQFGENEVKEMCKLLDIDL 377

  Fly   374 ICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYS 438
            |.|.||||:|||||||.::|||:||||:|...|.|:..:..|...|..||::|||.:.:.:.:..
 Worm   378 IVRGHQVVQDGYEFFAGKKLVTVFSAPHYMQSFTNSAAVCKVSAGLEVSFEVLKPEDIRVEEIKC 442

  Fly   439 GMNSS 443
            ...||
 Worm   443 SAESS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 127/282 (45%)
PP2Ac 160..430 CDD:197547 128/272 (47%)
C23G10.1NP_001367544.1 PP2Ac 162..432 CDD:197547 126/270 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.