DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and C06A1.3

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:371 Identity:144/371 - (38%)
Similarity:204/371 - (54%) Gaps:59/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ISADGDQITVHHPREEPKKSRLKLRDFF-----VAEFVRSC------------------RTGKQ- 157
            :|.||:. .....:|.||.|.:...|..     :||::..|                  .||.: 
 Worm     1 MSTDGNN-NKKGSKEGPKSSEISKFDLAKENPKLAEWMDDCIKRMNSLYKDTNINICNVMTGHEI 64

  Fly   158 ---VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLF 219
               ::|.||           ||:::..|.|.|||:.:.||||.||.|:.|||:..|..|....:|
 Worm    65 ISIIRMVEA-----------IFMEESNLCEAEAPIKVIGDIHAQYQDMNRLFDLIGRVPEEKLMF 118

  Fly   220 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTD 284
            ||||||||.|.:|.:.||...||:|.:..:|||||||..|:|:|||||.||:.:|.:.||..|..
 Worm   119 LGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKYGIGLWWDFQS 183

  Fly   285 CFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGEN 349
            |||.:|::.:|.:::.|.||||||:|..::.||.:.||.:..|.|||.|||||||....:||..:
 Worm   184 CFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHS 248

  Fly   350 DRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMT 414
            .||:|:.||..||.:.....|:|||.||||||:||||....|:|:|:||.||||.:|.||..::.
 Worm   249 IRGISYMFGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRLITVFSVPNYCAQFTNAAAVVC 313

  Fly   415 VDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQ----RSAPMLA 456
            ::..|..|||.:.|                |..|:    ::||.:|
 Worm   314 LNANLQISFQQMIP----------------PPLPEGTKAKAAPAIA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 128/300 (43%)
PP2Ac 160..430 CDD:197547 126/269 (47%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 128/300 (43%)
PP2Ac 59..329 CDD:197547 128/296 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.