DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and W03D8.2

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001249242.1 Gene:W03D8.2 / 171844 WormBaseID:WBGene00020985 Length:364 Species:Caenorhabditis elegans


Alignment Length:265 Identity:122/265 - (46%)
Similarity:167/265 - (63%) Gaps:14/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QVQMTEAEVRGLCLKSREIFLQQPILLEL-EAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFL 220
            :|.:|.:|:..|..|.::.||:||.|||: ..|:.:..|:|||...|||:|.....||...||||
 Worm    44 RVDITISEISQLTDKMKKAFLEQPALLEISNEPITVVADMHGQSIHLLRIFLTNEAPPNQKYLFL 108

  Fly   221 GDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC----KRRYNVKLWKT 281
            |||||||.||:..:|||...|.:||::.||||||||..:....|||||||    |.....|:|:.
 Worm   109 GDYVDRGSQSVVVMCLLFCMKHRYPQHVFLLRGNHEDVNTTLNYGFYDECLEQWKNDEGEKVWRM 173

  Fly   282 FTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDP-DKDVQG 345
            |.|.|||:|:||:|..|:||.|||:||.|:.:|.|..:.||..||..||.|||||||| ..:..|
 Worm   174 FIDTFNCMPLAAVIGGKVFCAHGGISPWLESLEDINSIERPLVVPPYGLACDLLWSDPAQPERNG 238

  Fly   346 WGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGY------EFFARRQLVTLFSAPNYCG 404
            ||.:.||:|||:|..||.:|..::::.|:.|.||:.::.|      .|..|  |::||||.||.|
 Worm   239 WGLSHRGISFTYGKSVVEEFCAKNDIALVIRGHQLFKEMYPQGCVLRFGGR--LISLFSALNYEG 301

  Fly   405 EFDNA 409
            ..:|:
 Worm   302 HKNNS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 122/265 (46%)
PP2Ac 160..430 CDD:197547 121/262 (46%)
W03D8.2NP_001249242.1 MPP_superfamily 45..306 CDD:301300 121/262 (46%)
PP2Ac 47..312 CDD:197547 121/262 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.