DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and Ppp4c

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_599186.1 Gene:Ppp4c / 171366 RGDID:621225 Length:307 Species:Rattus norvegicus


Alignment Length:300 Identity:135/300 - (45%)
Similarity:200/300 - (66%) Gaps:11/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 EFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGF 211
            |.:|.|...|     |:||:.||.|:|||.:::..:..:::|:.:|||||||:.||..||..||.
  Rat    12 EQLRRCELIK-----ESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGD 71

  Fly   212 PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-N 275
            .|..||||:||:||||..|:||..||||.|::||:...|:|||||...|.::|||||||.|:| :
  Rat    72 VPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGS 136

  Fly   276 VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPD 340
            |.:|:..|:.|:.|.::||||.||||.||||||.:|.::|||.:.|..:||..|.:||||||||:
  Rat   137 VTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPE 201

  Fly   341 KDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGE 405
             |..|||.:.||..:.||.|||::|...:::|:.|||||:|.:||::.....::|::||||||..
  Rat   202 -DTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMTCRAHQLVMEGYKWHFNETVLTVWSAPNYCYR 265

  Fly   406 FDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRP 445
            ..|...::.:|:.|...|.|.:.:.::.:    |:.|.:|
  Rat   266 CGNVAAILELDEHLQKDFIIFEAAPQETR----GIPSKKP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 131/279 (47%)
PP2Ac 160..430 CDD:197547 128/270 (47%)
Ppp4cNP_599186.1 PTZ00239 6..307 CDD:173488 134/299 (45%)
MPP_PP2A_PP4_PP6 6..290 CDD:277360 132/283 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.