DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and ppef1

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:451 Identity:119/451 - (26%)
Similarity:180/451 - (39%) Gaps:128/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GAGPGSSHDPLDDL--TEQQRRLLQQYSISPPSETMISADGDQITVHHPREEPKKSRLKLRDFFV 145
            |.||    |.:.|:  :::..:.:....|..|:    |..|.:||.               ...|
 Frog    83 GQGP----DLISDISNSKEGHKFIDYEKIEVPN----SYGGPRITF---------------PLTV 124

  Fly   146 AEFVRSCRTGKQVQMTEAE-VRGLCLKSREIFLQQPILLELEA----PLIICGDIHGQYTDLLRL 205
            ::.....|..||.|...|. |..|..::::...|.|.::.|..    .:.||||:||:..|||.:
 Frog   125 SDTNALLRAFKQGQQLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLI 189

  Fly   206 FEYGGFPPAAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDE 269
            |...|.|...| |||.||.|||||.|:|.:.||..:.:.||.|..:.|||||...:|..|||.:|
 Frog   190 FYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNLRYGFTNE 254

  Fly   270 CKRRY-----NVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGL--SPDLQGMEQIRR------LMR 321
            ..::|     |:.|  ...|.::.||:|.|:|.|:...|||:  ..||..:..|.|      |..
 Frog   255 VIQKYKGHARNILL--LLEDIYSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRT 317

  Fly   322 P-TD------------------------------------------------------------- 324
            | ||                                                             
 Frog   318 PKTDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEINYMDS 382

  Fly   325 ----------VPDT-----GLLCDLLWSDPDKDVQGWGEND-RGVSFTFGVDVVSKFLNRHELDL 373
                      :||:     ..:.|:||||| ::..|...|. ||....||.:|..|.|.::...:
 Frog   383 RIQLPDKMPELPDSIRKEWKQVVDILWSDP-RNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKM 446

  Fly   374 ICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTL---MCSFQILKPSEK 431
            :.|:|:..::|||.....::||:|||.||..|..|.|..:.:...|   ...:|:.|.:.|
 Frog   447 LIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVSKCTRK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 105/378 (28%)
PP2Ac 160..430 CDD:197547 102/369 (28%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 105/381 (28%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.