DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flw and hcfc2

DIOPT Version :9

Sequence 1:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster
Sequence 2:XP_004912959.2 Gene:hcfc2 / 100127587 XenbaseID:XB-GENE-991080 Length:833 Species:Xenopus tropicalis


Alignment Length:101 Identity:25/101 - (24%)
Similarity:40/101 - (39%) Gaps:28/101 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QVQMTEAEVRGLCLKSREIFLQQPILLELE------------APLIICGDIH------GQYTDLL 203
            |||:.:|......||..|:...:..:|:|.            |||.....::      |.|:..|
 Frog   419 QVQLIQATTNSFHLKWDELPTVEGYILQLNPESPASSIAGTPAPLSEISALNQGNGRSGDYSTTL 483

  Fly   204 RLFEYG--GFPPAANYLFLGDYVDRGKQSLETICLL 237
            .||:.|  |...|      ||..:..:|::.  |:|
 Frog   484 PLFQTGLLGSGEA------GDCQESPQQAVN--CIL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 25/101 (25%)
PP2Ac 160..430 CDD:197547 22/98 (22%)
hcfc2XP_004912959.2 PLN02193 <67..383 CDD:177844
KELCH repeat 81..119 CDD:276965
KELCH repeat 131..181 CDD:276965
KELCH repeat 185..245 CDD:276965
KELCH repeat 248..299 CDD:276965
KELCH repeat 303..369 CDD:276965
FN3 <658..689 CDD:238020
FN3 695..795 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.