DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and VLDLR

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_003374.3 Gene:VLDLR / 7436 HGNCID:12698 Length:873 Species:Homo sapiens


Alignment Length:455 Identity:135/455 - (29%)
Similarity:205/455 - (45%) Gaps:71/455 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPN---SVRAW-DPSLQPYEDNPCAHNNGNCSHLC--LLATNSQGFSCACPTGVKLIS 393
            |.||..|..|   ..|.| |..|:....|.|..|||.|||:|  |:.    |:.|.|..|.:||.
Human   330 ECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVI----GYECDCAAGFELID 390

  Fly   394 ANTC-----------------------------------------ANGSQEMMFIVQRTQISKIS 417
            ..||                                         |.|.:..:....|..|.||.
Human   391 RKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIG 455

  Fly   418 LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHAD---GTGVTDFVTSEVRHP 479
            |:..:|...   :.:::..:|:|.|...:.::|:|:....|..|..|   |..|.  :...|.:|
Human   456 LERKEYIQL---VEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVK--MIDNVYNP 515

  Fly   480 DGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKP 544
            ..:|:||:.:.:||||..:..|.|..||||.||.|....|.||.:|||.|..|:::||||.| ..
Human   516 AAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGE-PA 579

  Fly   545 KVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVIS--DNL 607
            |:|:|.::|.:|..||:.::.|||||.||:....:||.|.|...:...:::|..||:|:.  :.|
Human   580 KIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFL 644

  Fly   608 KHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKV-TRLREVRGQNACA-- 669
            .|...|:|.:|.:||.|.:..::..|:|.||:....:|:...|...:.| ..|.:..|:|.|.  
Human   645 AHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEED 709

  Fly   670 VRNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTCVVPAAFLLFSRQEHIGRISIEYNEG 728
            :.||||.:|||..|:      .|.|.|...|.:..:.|.|...|..:.:|..:......|....|
Human   710 MENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSG 774

  Fly   729  728
            Human   775  774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 55/217 (25%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 30/124 (24%)
NHL repeat 428..476 CDD:271320 10/50 (20%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 9/25 (36%)
Ldl_recept_b 534..573 CDD:278487 17/38 (45%)
LY 558..599 CDD:214531 14/40 (35%)
LY 600..641 CDD:214531 14/42 (33%)
FXa_inhibition 668..703 CDD:291342 14/42 (33%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
VLDLRNP_003374.3 LDLa 33..67 CDD:238060
LDLa 71..103 CDD:197566
Ldl_recept_a 111..149 CDD:278486
LDLa 154..188 CDD:238060
Ldl_recept_a 192..224 CDD:278486
Ldl_recept_a 237..273 CDD:278486
Ldl_recept_a 276..312 CDD:278486
Ldl_recept_a 320..350 CDD:278486 7/19 (37%)
FXa_inhibition 360..394 CDD:291342 15/37 (41%)
EGF_CA 396..426 CDD:214542 0/29 (0%)
Ldl_recept_b 481..521 CDD:278487 10/41 (24%)
LY 505..547 CDD:214531 16/43 (37%)
Ldl_recept_b 568..608 CDD:278487 18/40 (45%)
LY 592..634 CDD:214531 14/41 (34%)
Ldl_recept_b 655..694 CDD:278487 10/38 (26%)
FXa_inhibition 706..749 CDD:291342 14/42 (33%)
Mucin <751..813 CDD:250634 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.