DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and vldlr

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_002934223.1 Gene:vldlr / 733485 XenbaseID:XB-GENE-971958 Length:868 Species:Xenopus tropicalis


Alignment Length:432 Identity:130/432 - (30%)
Similarity:202/432 - (46%) Gaps:74/432 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPNSVR-AWDPSLQPYED---NPCAHNNGNCSHLC--LLATNSQGFSCACPTGVKLIS 393
            |.||..|..|..: ..|.|.:|.::   |.|..|||.|||||  |:.    |:.|.|..|.|||.
 Frog   328 ECIDIAKVCNKQKDCKDWSDEPIKECYVNECEVNNGGCSHLCHNLVI----GYECDCTAGFKLID 388

  Fly   394 ANTC-----------------------------------------ANGSQEMMFIVQRTQISKIS 417
            ..||                                         |.|.:..:....|..|.|:.
 Frog   389 RKTCGDIDECQNPEICSQICVNLKGGYKCECSKGYQMDPSTGVCKAVGREPCLIFTNRRDIRKVG 453

  Fly   418 LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHAD-----GTGVTDFVTSEVR 477
            |:..:|...   :.:::..:|:|.|..|:.::|:|.....|.||..|     ||.:.  |..:|.
 Frog   454 LERKEYIQL---VEQLRNTVALDADIKEQSLFWADTIQKAIFRAPFDTREKVGTHIK--VVEDVH 513

  Fly   478 HPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNER 542
            .|..:|:||:.:|:||.||....|.|...||:.||.|....|::|.:|||.|..|:::||||.| 
 Frog   514 SPSAIAIDWIYKNIYWMDTGLKTISVSNFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGE- 577

  Fly   543 KPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISDN- 606
            ..|:|:|.::|.:|...|:.::..|:|||:|:....:||.|.|...:...:::|..|||::..: 
 Frog   578 PAKIEKAGMNGIDRQQFVTADVQRPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHE 642

  Fly   607 -LKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKV-TRLREVRGQNAC- 668
             |.|...|:|.:|.:||.|.:..:|..|:|.:|.....:|:...:...:.| ..|.:..|:|.| 
 Frog   643 FLAHPLALTIFEDRVYWIDGENEAIYGANKFSGQELETLVNNLNEAQDVIVYHELVQPLGRNWCN 707

  Fly   669 -AVRNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTC 703
             .:.||||.:|||..|:      .|.|.|...:|| |..|:|
 Frog   708 EQIENGGCKYLCLPAPQISDNSPKYTCVCPDGFEL-NGGRSC 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 59/219 (27%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 30/124 (24%)
NHL repeat 428..476 CDD:271320 13/52 (25%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 10/25 (40%)
Ldl_recept_b 534..573 CDD:278487 15/38 (39%)
LY 558..599 CDD:214531 11/40 (28%)
LY 600..641 CDD:214531 14/42 (33%)
FXa_inhibition 668..703 CDD:291342 16/42 (38%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
vldlrXP_002934223.1 LDLa 31..65 CDD:238060
Ldl_recept_a 68..101 CDD:365841
Ldl_recept_a 109..147 CDD:365841
Ldl_recept_a 151..186 CDD:365841
LDLa 190..222 CDD:197566
Ldl_recept_a 236..271 CDD:365841
Ldl_recept_a 274..310 CDD:365841
LDLa 316..348 CDD:197566 7/19 (37%)
FXa_inhibition 358..392 CDD:373209 17/37 (46%)
EGF_CA 394..424 CDD:214542 0/29 (0%)
LY 505..547 CDD:214531 15/43 (35%)
LY 548..591 CDD:214531 18/43 (42%)
LY 592..634 CDD:214531 11/41 (27%)
Ldl_recept_b 655..694 CDD:393440 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.