DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and lrp8

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_005166314.1 Gene:lrp8 / 557734 ZFINID:ZDB-GENE-050506-134 Length:1008 Species:Danio rerio


Alignment Length:434 Identity:147/434 - (33%)
Similarity:219/434 - (50%) Gaps:73/434 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPNSVR-AWDPSLQPYED---NPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISAN 395
            |.||:.|..:::| ..|.|.:|.::   |.||.|||.|||:|  .....||.|.||:|.||:...
Zfish   332 ECIDSSKVCDTIRDCKDWSDEPVKECGLNECAINNGGCSHIC--KDRQIGFECQCPSGYKLLDKK 394

  Fly   396 TC-----------------------------------------ANGSQEMMFIVQRTQISKISLD 419
            ||                                         |.|....:....|.:|.:|.|.
Zfish   395 TCGDIDECENPEACSQICINLKGDYKCECYEGYEMDPVTKTCKAVGKSPYLMFTNRHEIRRIDLL 459

  Fly   420 SPDYT-IFPLPLGKVKYAIAIDYDPVEEHIYWSDV------ETYTIKRAHADGTGVTDFVTSEVR 477
            ..||| :.|    .:|.|:|:|.|.....:||.|:      ..| |.:|:.....:| .:.:.:.
Zfish   460 KKDYTQVVP----TLKNAVALDVDVTTNKMYWCDLYHRKIFSAY-INKANNSSEQIT-LIDTALH 518

  Fly   478 HPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNER 542
            .|:|||:||:.:|:||||:....|.|..:||..|||||...|.|||||||.|..|:|:||||. .
Zfish   519 SPEGLAMDWVHKNIYWTDSGHKTISVANVDGKKRKVLIDTELGEPRAIAVDPRQGFMYWSDWG-A 582

  Fly   543 KPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVIS--D 605
            :.|:|:|.::|.:|.|||||.:.||||||||:.:..:||.|.|...|...:::|..||:::|  |
Zfish   583 QAKIEKAGMNGVDRQVLVSERIEWPNGIALDLSSSRLYWVDSKLHLISSVDLNGDNRRILLSSMD 647

  Fly   606 NLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKV-TRLREVRGQNAC- 668
            .|.|.|.|::.:|.:||||.:..:|...:::|||:.:::.....:.:.:.| ..||:.:..:.| 
Zfish   648 QLGHPFALTLFEDRVYWTDLEYEAIYSVNRLTGNDVVMLAQHLNNPLDVVVFHELRQPKVPDTCN 712

  Fly   669 --AVRNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTCV 704
              .:.||||.:|||..|:      .|.|.|....||..|.|.||
Zfish   713 MGNLPNGGCEYLCLRAPQITEHSPKYTCACPDSMELGPDMRRCV 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 62/219 (28%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 30/122 (25%)
NHL repeat 428..476 CDD:271320 12/53 (23%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 12/25 (48%)
Ldl_recept_b 534..573 CDD:278487 21/38 (55%)
LY 558..599 CDD:214531 19/40 (48%)
LY 600..641 CDD:214531 16/42 (38%)
FXa_inhibition 668..703 CDD:291342 16/43 (37%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
lrp8XP_005166314.1 LDLa 66..98 CDD:197566
Ldl_recept_a 107..144 CDD:278486
Ldl_recept_a 191..224 CDD:278486
Ldl_recept_a 240..274 CDD:278486
Ldl_recept_a 278..313 CDD:278486
LDLa 322..352 CDD:197566 7/19 (37%)
FXa_inhibition 362..396 CDD:291342 17/35 (49%)
EGF_CA 398..428 CDD:214542 0/29 (0%)
LY 463..504 CDD:214531 13/45 (29%)
LY 511..552 CDD:214531 16/41 (39%)
Ldl_recept_b 573..613 CDD:278487 22/40 (55%)
LY 597..639 CDD:214531 19/41 (46%)
Ldl_recept_b 660..699 CDD:278487 9/38 (24%)
FXa_inhibition 718..755 CDD:291342 15/36 (42%)
IgaA 913..>985 CDD:284503
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.