DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment arr and Cd320

DIOPT Version :9

Sequence 1:	NP_524737.2	Gene:	arr / 44279	FlyBaseID:	FBgn0000119	Length:	1678	Species:	Drosophila melanogaster
Sequence 2:	NP_062294.3	Gene:	Cd320 / 54219	MGIID:	1860083	Length:	260	Species:	Mus musculus

Alignment Length:	126	Identity:	47/126 - (37%)
Similarity:	64/126 - (50%)	Gaps:	21/126 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly  1318 ACGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSC-QSGECIDKS 1381
            :|..|.|.|.  .||.      |:|.||||||.:||.|.|||   ..||.:  || |:|:|..:|
Mouse    46 SCPTDTFQCL--TSGY------CVPLSWRCDGDQDCSDGSDE---EDCRIE--SCAQNGQCQPQS 97

  Fly  1382 LV---CDGTTNCANGHDEADCCKRP----GEFQCPINKLCISAALLCDGWENCADGADESS 1435
            .:   ||..:.|::..|:...|.||    .|..|.::.:||.....|||..:|.|.:||.|
Mouse    98 ALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELS 158

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
arr	NP_524737.2	LY	162..201	CDD:214531
		NHL	168..503	CDD:302697
		NHL repeat	172..237	CDD:271320
		LY	252..293	CDD:214531
		NHL repeat	261..298	CDD:271320
		NHL repeat	303..339	CDD:271320
		NHL repeat	341..419	CDD:271320
		NHL repeat	428..476	CDD:271320
		LY	472..511	CDD:214531
		NHL repeat	477..503	CDD:271320
		Ldl_recept_b	534..573	CDD:278487
		LY	558..599	CDD:214531
		LY	600..641	CDD:214531
		FXa_inhibition	668..703	CDD:291342
		LY	739..773	CDD:214531
		LY	776..818	CDD:214531
		LY	819..860	CDD:214531
		FXa_inhibition	973..1010	CDD:291342
		LY	1122..1164	CDD:214531
		FXa_inhibition	1273..1313	CDD:291342
		LDLa	1319..1362	CDD:238060	20/42 (48%)
		LDLa	1365..1399	CDD:238060	12/37 (32%)
		LDLa	1399..1433	CDD:197566	12/37 (32%)
Cd320	NP_062294.3	LDLa	47..82	CDD:238060	20/45 (44%)
Cd320	NP_062294.3	LDLa	124..159	CDD:238060	12/35 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900