| Sequence 1: | NP_524737.2 | Gene: | arr / 44279 | FlyBaseID: | FBgn0000119 | Length: | 1678 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_057663.1 | Gene: | CD320 / 51293 | HGNCID: | 16692 | Length: | 282 | Species: | Homo sapiens |
| Alignment Length: | 227 | Identity: | 57/227 - (25%) |
|---|---|---|---|
| Similarity: | 97/227 - (42%) | Gaps: | 39/227 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1318 ACGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSGECIDK-- 1380
Fly 1381 -SLVCDGTTNCANGHDE--ADCCK---RPGEFQCPINKLCISAALLCDGWENCADGADE----SS 1435
Fly 1436 DICLQ---RRMAPATDKRAFMILIGATM----ITIFSIVYLLQFCRTRIGKSRTEPKDDQATDPL 1493
Fly 1494 SPSTLSKSQRVSKIASVADAVRMSTLNSRNSM 1525 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| arr | NP_524737.2 | LY | 162..201 | CDD:214531 | |
| NHL | 168..503 | CDD:302697 | |||
| NHL repeat | 172..237 | CDD:271320 | |||
| LY | 252..293 | CDD:214531 | |||
| NHL repeat | 261..298 | CDD:271320 | |||
| NHL repeat | 303..339 | CDD:271320 | |||
| NHL repeat | 341..419 | CDD:271320 | |||
| NHL repeat | 428..476 | CDD:271320 | |||
| LY | 472..511 | CDD:214531 | |||
| NHL repeat | 477..503 | CDD:271320 | |||
| Ldl_recept_b | 534..573 | CDD:278487 | |||
| LY | 558..599 | CDD:214531 | |||
| LY | 600..641 | CDD:214531 | |||
| FXa_inhibition | 668..703 | CDD:291342 | |||
| LY | 739..773 | CDD:214531 | |||
| LY | 776..818 | CDD:214531 | |||
| LY | 819..860 | CDD:214531 | |||
| FXa_inhibition | 973..1010 | CDD:291342 | |||
| LY | 1122..1164 | CDD:214531 | |||
| FXa_inhibition | 1273..1313 | CDD:291342 | |||
| LDLa | 1319..1362 | CDD:238060 | 18/42 (43%) | ||
| LDLa | 1365..1399 | CDD:238060 | 10/38 (26%) | ||
| LDLa | 1399..1433 | CDD:197566 | 11/36 (31%) | ||
| CD320 | NP_057663.1 | LDLa | 54..89 | CDD:238060 | 18/45 (40%) |
| LDLa | 132..167 | CDD:238060 | 12/34 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||