DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and LRP3

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_005259002.1 Gene:LRP3 / 4037 HGNCID:6695 Length:785 Species:Homo sapiens


Alignment Length:563 Identity:137/563 - (24%)
Similarity:191/563 - (33%) Gaps:184/563 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1227 WLDDKTGVERITVN-----------------GERRSAELQRLPQITDIRAVWTPDPKVLRNHTCM 1274
            ||.|.....|:.:.                 |||....||.|...::.|.| :.:....|.....
Human   284 WLVDTQDSRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPV-SLEAAQGRLTVAY 347

  Fly  1275 HSRTKCSHICIASGEGIARTRDV---CSCPKHLMLLEDKENCGAFPACGPDHFTCAAPVSGISDV 1336
            |:|.:      ::|.|...|..|   |        |..::.||:           ::...|.|..
Human   348 HARAR------SAGHGFNATYQVKGYC--------LPWEQPCGS-----------SSDSDGGSLG 387

  Fly  1337 NKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQ--SGECIDKSLVCDGTTNCANGHDEADC 1399
            ::.|.....||||...|....||.|||.|..||:.|:  ||.|...:..|:...:|.:|.||.:|
Human   388 DQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNC 452

  Fly  1400 --CKRPGEFQCPINKLCISAALLCDGWENCADGADESSDICLQRRMAPATDKRAFMILIGATMIT 1462
              | :||.|.|..| |||.....|||.|:|.||:||..  ||    |....|.....|||:.:..
Human   453 FSC-QPGTFHCGTN-LCIFETWRCDGQEDCQDGSDEHG--CL----AAVPRKVITAALIGSLVCG 509

  Fly  1463 IFSIVYL-----LQFCRTRIGKSRTEPKDDQATDPLSPSTLSKS--------------------- 1501
            :..::.|     |...||:..:||..    |:..|  |.|.|::                     
Human   510 LLLVIALGCAFKLYSLRTQEYRSRAA----QSCRP--PPTASRAFETQMTRLEAEFVRREAPPSY 568

  Fly  1502 -QRVSK--IASVAD-----AVRMSTL-NSRNSMNSYDRNH------------------------- 1532
             |.:::  |..|.|     |.:.|.| |.|.:|....|.|                         
Human   569 GQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAP 633

  Fly  1533 ------ITGA-SSSTTNGSSMVAYPINPPPSPATRSRRPYRHYKIINQPPPPTPCSTDICDESDS 1590
                  :|.| .|.|..|...    :.|.|..|               |.||.|..     ::.|
Human   634 RGQIPLLTAARPSQTVLGDGF----LQPAPGAA---------------PDPPAPLM-----DTGS 674

  Fly  1591 NYTSKSNSNNSNGGATKHSSSSA--------AACLQYGYD----SEPYPPPPTPRSHYHSDVRIV 1643
            ...:.....::.|.|.:...|..        ..|.....|    .||....|.|     :|....
Human   675 TRAAGDRPPSAPGRAPEVGPSGPPLPSGLRDPECRPVDKDRKVCREPLVDGPAP-----ADAPRE 734

  Fly  1644 PESSCPPSP--SSRSSTYF----SPL-----PPPP-SPVQSPS 1674
            |.|:..|.|  |:.|||..    .||     |||| ||:...|
Human   735 PCSAQDPHPQVSTASSTLGPHSPEPLGVCRNPPPPCSPMLEAS 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320
NHL repeat 428..476 CDD:271320
LY 472..511 CDD:214531
NHL repeat 477..503 CDD:271320
Ldl_recept_b 534..573 CDD:278487
LY 558..599 CDD:214531
LY 600..641 CDD:214531
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342 8/42 (19%)
LDLa 1319..1362 CDD:238060 10/42 (24%)
LDLa 1365..1399 CDD:238060 12/35 (34%)
LDLa 1399..1433 CDD:197566 17/35 (49%)
LRP3XP_005259002.1 CUB 43..156 CDD:238001
LDLa 166..200 CDD:238060
LDLa 212..249 CDD:238060
CUB 254..364 CDD:238001 18/86 (21%)
LDLa 416..452 CDD:238060 12/35 (34%)
LDLa 455..489 CDD:238060 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.