DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and vldlr

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_005155618.1 Gene:vldlr / 393897 ZFINID:ZDB-GENE-040426-803 Length:877 Species:Danio rerio


Alignment Length:473 Identity:137/473 - (28%)
Similarity:220/473 - (46%) Gaps:91/473 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPNSVR---AW-DPSLQPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISAN 395
            |.|:..|..|.||   .| |..::....|.|..|||.|||:|...|  .||.|.|..|::||...
Zfish   326 ECIEMSKVCNKVRDCPDWSDEPIKECNMNECLINNGGCSHICRDLT--IGFECDCTPGLQLIDRK 388

  Fly   396 TC-----------------------------------------ANGSQEMMFIVQRTQISKISLD 419
            ||                                         |.|.:..:....|..|.|:.|:
Zfish   389 TCGDVNECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTNRRDIRKLGLE 453

  Fly   420 SPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTI--------KRAHADGTGVTDFVTSEV 476
            ..:||..   :.:::..:|:|.|.:::.|:|:|:....|        ..:|..       |..:|
Zfish   454 RREYTQI---VEQLRNTVALDADFIQQMIFWADLGQKAIFSTVLDKQDESHKK-------VIDDV 508

  Fly   477 RHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNE 541
            :.|.|:|:||:.:|:||:|..:..|.|...:||.:|||....|:||.:|||.|..|:::||||.|
Zfish   509 QMPVGIAVDWIYKNIYWSDLGSKSITVANFNGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGE 573

  Fly   542 RKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVIS-- 604
             ..|:|::.::|::|.|||..::.|||||.||:....:||.|.|...:...:::|..||.|:.  
Zfish   574 -PAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSP 637

  Fly   605 DNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKV-TRLREVRGQNAC 668
            |.|.|.|.|::.:|.::|||.:..:|..|:|.||::..::.....:...:.| ..|.::.|.|.|
Zfish   638 DYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQLSGTNWC 702

  Fly   669 --AVRNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTCVVPAAFL-------LFSRQEH- 717
              .:.|||||.:||..|:      .|.|.|.....||:|...|...|...       :.:|..| 
Zfish   703 NEKMENGGCSFMCLPAPQINKHSPKYTCVCPEGQTLASDGLRCRAEATSAAPQDGGQVTTRPSHP 767

  Fly   718 ----IGRISIE--YNEGN 729
                :.:::.|  :.|||
Zfish   768 KASSVSKVASEPVHTEGN 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 55/220 (25%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 30/122 (25%)
NHL repeat 428..476 CDD:271320 9/55 (16%)
LY 472..511 CDD:214531 15/38 (39%)
NHL repeat 477..503 CDD:271320 10/25 (40%)
Ldl_recept_b 534..573 CDD:278487 17/38 (45%)
LY 558..599 CDD:214531 15/40 (38%)
LY 600..641 CDD:214531 16/42 (38%)
FXa_inhibition 668..703 CDD:291342 15/42 (36%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
vldlrXP_005155618.1 LDLa 29..63 CDD:238060
LDLa 67..99 CDD:197566
Ldl_recept_a 107..145 CDD:278486
Ldl_recept_a 149..184 CDD:278486
Ldl_recept_a 234..269 CDD:278486
Ldl_recept_a 272..308 CDD:278486
LDLa 316..346 CDD:238060 7/19 (37%)
FXa_inhibition 356..390 CDD:291342 16/35 (46%)
EGF_CA 392..426 CDD:214542 0/33 (0%)
NHL 479..>570 CDD:302697 32/97 (33%)
LY 504..541 CDD:214531 13/36 (36%)
NHL repeat 511..551 CDD:271320 16/39 (41%)
Ldl_recept_b 564..604 CDD:278487 18/40 (45%)
LY 588..630 CDD:214531 15/41 (37%)
Ldl_recept_b 651..690 CDD:278487 9/38 (24%)
FXa_inhibition 707..745 CDD:291342 14/37 (38%)
Mucin <723..817 CDD:250634 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.