DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and ldlra

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_001025454.1 Gene:ldlra / 387529 ZFINID:ZDB-GENE-031217-1 Length:911 Species:Danio rerio


Alignment Length:433 Identity:128/433 - (29%)
Similarity:193/433 - (44%) Gaps:109/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 ELIDTPKAPN---SVRAW-DPSLQPYEDNPCAHNNGNCSHLCLLATNSQ--GFSCACPTGVKLI- 392
            |.|...|..|   ..|.| |..|:..:.|.|.:|||.|||:|    |..  |:.|.||||.:|: 
Zfish   284 ECISMEKVCNKQRDCRDWSDEPLRECDSNECLYNNGGCSHIC----NDLKIGYECLCPTGFRLVD 344

  Fly   393 -----SANTCAN-----------------------------------GSQEMMFIVQRTQISKIS 417
                 ..:.|||                                   |:...:|...|.::.|::
Zfish   345 KRRCEDIDECANPDTCSQICVNQMGSYKCECEDGYQMDPASKACKAIGTIAYLFFTNRHEVRKMT 409

  Fly   418 LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDV---ETYTIKRAHADGTGVTDFVTSEVRHP 479
            ||..:| |..:|  ::|..:|:|.:.....|||||:   :.|:|:.|                  
Zfish   410 LDRSEY-IRVIP--RLKNVVALDMNIASRDIYWSDLSLKKIYSIRGA------------------ 453

  Fly   480 DGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKP 544
                                 |.|...||:.||.|..|:|.:||||.|.|...:|||:||. ...
Zfish   454 ---------------------ISVATADGSRRKTLFKENLAKPRAIVVDPIKNFMFWTDWG-TPA 496

  Fly   545 KVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISD--NL 607
            |:|::.|:|.:|..||::::.|||||.||:..:.:||.|.|...:...::.|.|||.:|.|  .|
Zfish   497 KIEKSGLNGVDRSTLVADDIVWPNGITLDLLTERLYWVDSKLHTLSSISVQGDGRRTLIIDQGKL 561

  Fly   608 KHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQY--PDLMGLKVTRLREVRGQNACAV 670
            .|...|::.::.::|||....:|..|:::||.:...|.:..  |:.:.| ...|::..|.|.|.:
Zfish   562 AHPLSLTVFEEKVFWTDVSNNAILSANRVTGGDITKVAEHLSSPEDIVL-FHNLKQPTGINWCRI 625

  Fly   671 RNGGCSHLCLNRPR------DYVCRCAIDYELANDKRTCVVPA 707
            .||||..|||..|:      .|.|.|..:..||.|.|.| |||
Zfish   626 NNGGCEFLCLAAPQINRFSPKYTCACPDNMMLARDMRKC-VPA 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 49/217 (23%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320 2/3 (67%)
NHL repeat 341..419 CDD:271320 30/124 (24%)
NHL repeat 428..476 CDD:271320 12/50 (24%)
LY 472..511 CDD:214531 4/38 (11%)
NHL repeat 477..503 CDD:271320 1/25 (4%)
Ldl_recept_b 534..573 CDD:278487 17/38 (45%)
LY 558..599 CDD:214531 14/40 (35%)
LY 600..641 CDD:214531 13/42 (31%)
FXa_inhibition 668..703 CDD:291342 16/40 (40%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
ldlraNP_001025454.1 LDLa 23..55 CDD:197566
Ldl_recept_a 63..101 CDD:365841
LDLa 106..140 CDD:238060
LDLa 144..176 CDD:197566
Ldl_recept_a 192..227 CDD:365841
Ldl_recept_a 231..266 CDD:365841
LDLa 274..304 CDD:238060 6/19 (32%)
FXa_inhibition 314..348 CDD:373209 16/37 (43%)
EGF_CA 350..380 CDD:214542 3/29 (10%)
Ldl_recept_b 437..481 CDD:278487 21/82 (26%)
Ldl_recept_b 485..525 CDD:278487 17/40 (43%)
LY 510..551 CDD:214531 14/40 (35%)
Ldl_recept_b 572..611 CDD:278487 10/39 (26%)
FXa_inhibition 623..664 CDD:373209 16/40 (40%)
PHA03247 <666..808 CDD:223021 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.