DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and cue

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:419 Identity:101/419 - (24%)
Similarity:163/419 - (38%) Gaps:114/419 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 AIDYDPVEEHIYWSDVE-----TYTIKRAHADGTGVTDFVTSEVRHPD--GLALDWLARNLYWTD 495
            |:.:|..||.||::|::     .:::||.......|.:...:...:..  |||.|.|..||:|:|
  Fly    63 ALTFDESEELIYFNDLKHRNGSIFSLKRDLIAANHVAEQTIARTGNESVGGLAYDPLNMNLFWSD 127

  Fly   496 TVTDRIEVCRLDGTARKVLIYEHLEE---PRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERV 557
            |...:|....:.|:|...::.:...|   |..:||......::|::.|...|.|||.:||||.|.
  Fly   128 TEQRKIFFAPIHGSATPQVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPTVERINLDGSNRT 192

  Fly   558 VLVSENLGWPNGIALDIEAKAIYWCD---GKTDKIEVANMDGSGRRVVISDNLKHLFGLSILDDY 619
            |::|.|:..|.||.:|..:..::|.|   |....:|.:.:|||.|:||:.|.......|::.:|.
  Fly   193 VIISSNIDMPRGIVVDQLSDRLFWIDDLKGVFFSVESSKLDGSDRQVVLKDKHHEPLNLAVTNDA 257

  Fly   620 LYWTDWQRRSIDRAH------KITGNNR---------IVVVDQYP---DLMGLKVTRL-REVRGQ 665
            :||||...|:: .:|      |:|..::         ....|..|   |...::|..| .|.|| 
  Fly   258 IYWTDRTTRAV-WSHPKVPVIKVTTTSKPDEEDSTDSTDFKDPEPVAEDCPLVRVANLSEEARG- 320

  Fly   666 NACAVRNGGCSHLCLNRPRDYVC----------------------------------RCAID--Y 694
              ...|.|....|    .:|:.|                                  ||..|  |
  Fly   321 --IVARTGFYQRL----QKDHHCASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMNDGEY 379

  Fly   695 ELANDKRTCVVPAAFLLFSRQEHIGRISIEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTD 759
            ..|.|  .|:.|..|                 :|:.       .::|:.|       ...::.|.
  Fly   380 RAATD--LCICPTGF-----------------KGSR-------CEIRECH-------NYCVHGTC 411

  Fly   760 QKS-----KCIFRAFLNGSYVQRIVDSGL 783
            |.|     ||..:....|...:..|.|||
  Fly   412 QMSELAYPKCYCQPGFKGERCELSVCSGL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 21/71 (30%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320
NHL repeat 428..476 CDD:271320 10/42 (24%)
LY 472..511 CDD:214531 12/40 (30%)
NHL repeat 477..503 CDD:271320 11/27 (41%)
Ldl_recept_b 534..573 CDD:278487 17/38 (45%)
LY 558..599 CDD:214531 14/43 (33%)
LY 600..641 CDD:214531 13/46 (28%)
FXa_inhibition 668..703 CDD:291342 11/70 (16%)
LY 739..773 CDD:214531 7/38 (18%)
LY 776..818 CDD:214531 4/8 (50%)
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
cueNP_612113.2 LY 101..141 CDD:214531 11/39 (28%)
Ldl_recept_b 167..208 CDD:278487 17/40 (43%)
LY 193..237 CDD:214531 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461684
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.