DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and Lrp8

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:XP_006238632.1 Gene:Lrp8 / 362558 RGDID:1305729 Length:1013 Species:Rattus norvegicus


Alignment Length:405 Identity:123/405 - (30%)
Similarity:199/405 - (49%) Gaps:68/405 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 NPCAHNNGNCSHLCLLATNSQ-GFSCACPTGVKLISANTCAN----------------------- 399
            |.|.||||.|||:|   |:.: ||.|.||.|.:|:...||.:                       
  Rat   388 NECLHNNGGCSHIC---TDLKIGFECTCPAGFQLLDQKTCGDIDECQDPDACSQICVNYKGYFKC 449

  Fly   400 -------------------GSQEMMFIVQRTQISKISLDSPDYT-IFPLPLGKVKYAIAIDYDPV 444
                               |....:....|.::.:|.|...||: :.|:    :|..:|:|.:..
  Rat   450 ECHPGYEMDTLTKNCKAVAGRSPSLIFTNRHEVRRIDLVKRDYSRLIPM----LKNVVALDVEVD 510

  Fly   445 EEHIYWSDVETYTIKRAHADGTGVTD----FVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCR 505
            ...|||.|:....|..||.|...:.|    .:..::..|:|||:||:.:::||||:....:.|..
  Rat   511 TNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIGEQLHSPEGLAVDWVHKHIYWTDSGNKTVSVAT 575

  Fly   506 LDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGI 570
            .||..|..|....|.|||||||.|..|:|:||||. .:.|:|:|.|:|::|..|||:|:.|||||
  Rat   576 TDGRRRCTLFNRDLSEPRAIAVDPLRGFMYWSDWG-FQAKIEKAGLNGADRQTLVSDNIEWPNGI 639

  Fly   571 ALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVI--SDNLKHLFGLSILDDYLYWTDWQRRSIDRA 633
            .||:.::.:||.|.|..::...:.:|..|:::|  :|.|.|.||:::.:|.::|||.:..:|..|
  Rat   640 TLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSA 704

  Fly   634 HKITGNNRIVVVDQYPDLMGLKV-TRLREVRGQNAC---AVRNGGCSHLCLNRPR------DYVC 688
            :::.|....::.:...:...:.: ..|::.:..:||   |..||||.:|||..|:      .|.|
  Rat   705 NRLNGLEISILAENLNNPHDIVIFHELKQPKAADACELSAQPNGGCEYLCLPAPQISSHSPKYTC 769

  Fly   689 RCAIDYELANDKRTC 703
            .|.....|..|.:.|
  Rat   770 ACPDTMWLGPDMKRC 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 49/191 (26%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320 23/102 (23%)
NHL repeat 428..476 CDD:271320 12/51 (24%)
LY 472..511 CDD:214531 13/38 (34%)
NHL repeat 477..503 CDD:271320 10/25 (40%)
Ldl_recept_b 534..573 CDD:278487 20/38 (53%)
LY 558..599 CDD:214531 16/40 (40%)
LY 600..641 CDD:214531 13/42 (31%)
FXa_inhibition 668..703 CDD:291342 15/43 (35%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Lrp8XP_006238632.1 LDLa 44..78 CDD:238060
LDLa 82..114 CDD:197566
LDLa 124..160 CDD:238060
LDLa 203..235 CDD:197566
LDLa 256..289 CDD:238060
LDLa 295..329 CDD:238060
LDLa 333..369 CDD:294076
FXa_inhibition 390..424 CDD:291342 17/36 (47%)
EGF_CA 426..456 CDD:214542 0/29 (0%)
LY 495..530 CDD:214531 11/38 (29%)
LY 540..581 CDD:214531 13/40 (33%)
Ldl_recept_b 602..642 CDD:278487 21/40 (53%)
LY 626..668 CDD:214531 16/41 (39%)
Ldl_recept_b 689..728 CDD:278487 7/38 (18%)
FXa_inhibition 747..784 CDD:291342 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.