DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arr and Ndg

DIOPT Version :9

Sequence 1:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_610575.1 Gene:Ndg / 36089 FlyBaseID:FBgn0026403 Length:1350 Species:Drosophila melanogaster


Alignment Length:375 Identity:113/375 - (30%)
Similarity:179/375 - (47%) Gaps:76/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 EDNPCAHN------NGNCSHLCLLATNSQGFSCACPTGVKLISANTCANGS---------QEMMF 406
            |:..|.:|      |..|.     :||| |..|.|..|.       ..|||         .:.:.
  Fly   997 EEQNCLNNPTLCDMNAQCR-----STNS-GLVCVCNQGF-------FGNGSLCQERQHQDSDFLI 1048

  Fly   407 IVQRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGTGVTDF 471
            :.|...|:::.|:..:..    |:...:.||.:|.|.||..:||.|:.|..|.....|||.:..|
  Fly  1049 VSQGVMIARVPLNGRNVR----PISVAQMAIGLDKDCVEGRVYWGDISTKKIVSTKYDGTDLRPF 1109

  Fly   472 VTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDG-TARKVLIYEHLEEPRAIAVAPSLGWMF 535
            :|:::..|:|:|:|.::|.|||.|:..|.|||..||. :.|.|:|.:.|..||.|||.|....:|
  Fly  1110 ITTDIESPEGIAIDVISRRLYWADSAKDTIEVASLDDPSLRAVIINKQLVNPRGIAVDPYREKLF 1174

  Fly   536 WSDWNERKPKVERASLDGSERVVLV-SENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGR 599
            ||||:...||:|.::|||:.|.:|: .:::..||.:.:...:..:.:.|..|.|:|.  ::...|
  Fly  1175 WSDWDRESPKIEMSNLDGTGRELLLGKDDVTLPNSLVVLENSGEVCYADAGTKKVEC--IEPQNR 1237

  Fly   600 RV-VISDNLKHLFGLSILDDYLYWTDWQRRSID-----------------RAHKITGNNRIVVVD 646
            :: .||:.|.:.||::...|..|||||..:.::                 .:||:.|   :.||:
  Fly  1238 QIRTISNELSYPFGITFTHDQFYWTDWTTKKVEIVDSLGARQTPIQPPFFGSHKMYG---MTVVE 1299

  Fly   647 QY-PDLMGLKVTRLREVRGQNACAVRNGGC--SHLCL-NR--PRDYVCRC 690
            |: |..             |:.|.:.||||  |.||| ||  |....|:|
  Fly  1300 QHCPQY-------------QSPCQISNGGCTDSRLCLVNRQAPSGKSCKC 1336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531
NHL 168..503 CDD:302697 46/160 (29%)
NHL repeat 172..237 CDD:271320
LY 252..293 CDD:214531
NHL repeat 261..298 CDD:271320
NHL repeat 303..339 CDD:271320
NHL repeat 341..419 CDD:271320 17/76 (22%)
NHL repeat 428..476 CDD:271320 17/47 (36%)
LY 472..511 CDD:214531 16/39 (41%)
NHL repeat 477..503 CDD:271320 11/25 (44%)
Ldl_recept_b 534..573 CDD:278487 15/39 (38%)
LY 558..599 CDD:214531 7/41 (17%)
LY 600..641 CDD:214531 14/58 (24%)
FXa_inhibition 668..703 CDD:291342 14/28 (50%)
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
NdgNP_610575.1 NIDO 108..262 CDD:214712
EGF_3 285..320 CDD:372403
G2F 322..549 CDD:214774
EGF_CA 591..627 CDD:311536
EGF_3 797..828 CDD:372403
EGF_3 836..873 CDD:372403
EGF_3 963..995 CDD:372403
EGF_3 1001..1036 CDD:372403 14/47 (30%)
NHL 1059..>1275 CDD:302697 74/221 (33%)
NHL repeat 1067..1103 CDD:271320 12/35 (34%)
Ldl_recept_b 1084..1123 CDD:393440 13/38 (34%)
LY 1107..1145 CDD:214531 15/37 (41%)
NHL repeat 1117..1154 CDD:271320 17/36 (47%)
LY 1152..1195 CDD:214531 20/42 (48%)
NHL repeat 1161..1198 CDD:271320 18/36 (50%)
NHL repeat 1204..1245 CDD:271320 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.